280,000+ results for treat
- Natural Pet Treats Unlimited Natural Dog Treat Chew Best Norway Selling BrandOpens in a new window or tabBrand NewS$ 6.77 to S$ 44.13Customs services and international tracking providedpawstradinguk (136,121) 99.7%+S$ 35.44 shipping estimatefrom United Kingdom
- WHIMZEES Natural Dental Dog Treats Rice Bone, 50 Count ( pack of 1 )Opens in a new window or tabBrand NewS$ 74.67Customs services and international tracking providedpetcentral2012 (84,865) 99.1%+S$ 93.20 shipping estimatefrom United Kingdom3 watchers
- 10Pack Dental Endo Files G3-Pro Gold Taper Niti Endodontic Treat Root Canal FileOpens in a new window or tabBrand NewS$ 198.89Top-rated sellerTop-rated sellerdentalsupply-easyinsmile (420) 99%Free International Shippingfrom United States
- Obedient Aussie Dog Chew Premium Dog Treat Value Pack For All Size DogsOpens in a new window or tabBrand NewS$ 22.44obedient-aussie-dog-chew (19) 100%+S$ 18.30 postagefrom Australia
- New ListingVTG NEW Thomas the Tank Engine Treat Boxes (2) 1990 -Party Invitations (2) 1991Opens in a new window or tabBrand NewS$ 44.23luckyfindingsthrift (28) 100%+S$ 47.42 postagefrom United States
- Fastway Trick Or Treat (CD)Opens in a new window or tabAnother great item from Rarewaves USA | Free delivery!Brand NewS$ 18.07Top-rated sellerTop-rated sellerrarewaves-usa-ca (52,797) 97.8%+S$ 4.30 postagefrom United States
- New ListingBachelor Girl - Treat Me Good - 1998 CD SingleOpens in a new window or tabPre-OwnedS$ 4.49Top-rated sellerTop-rated sellerbangin_retro_wares (2,302) 99.9%+S$ 24.40 postagefrom Australia
- Greenies Original Large Size 8 count 12 oz Dental Chew Treats for DogsOpens in a new window or tabBrand NewS$ 33.51Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 10.78 postagefrom United States
- Greenies Dental Treats Original For Regular Dogs 25-50 Pounds. 6-CountOpens in a new window or tabBrand NewS$ 17.62Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 9.26 postagefrom United States
- Pet Center Quakers Duck Breast Fillets Treat Slow Roasted Low-Fat Chew Food 3 ozOpens in a new window or tabBrand NewS$ 13.93Top-rated sellerTop-rated sellerList price: S$ 15.67 11% offlittle.family.members (162,413) 99.1%+S$ 7.14 postagefrom United States
- Coffee Wood Dog Chew Natural Vegan Chewing Stick Dental Care Training TreatOpens in a new window or tabBrand NewS$ 9.89 to S$ 21.21Customs services and international tracking provided**vetfleece** (22,259) 98.9%+S$ 26.28 shipping estimatefrom United Kingdom
- Dog Treat Bundle - Bakers Rewards (4 Packs), Dog Toy & Extra Strong Waste BagsOpens in a new window or tabBrand NewS$ 19.09Customs services and international tracking providedbp_stores (1,054) 99.3%+S$ 48.73 shipping estimatefrom United Kingdom
- Treat CD The EndgameOpens in a new window or tabBrand NewS$ 78.97Top-rated sellerTop-rated sellern-lion (8,453) 99.4%Free International Shippingfrom Japan
- Pork Sausages Natural Dog Chew Treat Protein Healthy Snack - Dog Pick and MixOpens in a new window or tabBrand NewS$ 7.06 to S$ 40.88Customs services and international tracking providedplantsparty (4,803) 98.3%+S$ 36.61 shipping estimatefrom United Kingdom
- Extra Large XL Pigs Ears Dog Treat ChewOpens in a new window or tabBrand NewS$ 25.42 to S$ 49.19Customs services and international tracking providedatipharm619 (282) 100%+S$ 50.16 shipping estimatefrom United Kingdom
- Obedient Aussie Dog Chew Premium Dog Treat XXL Pack For Dogs over 32kgOpens in a new window or tabBrand NewS$ 24.39obedient-aussie-dog-chew (19) 100%+S$ 18.30 postagefrom Australia
- Dog Treat Sausages 70% Meat High Quality Grain Free Choice of Flavors UK MADEOpens in a new window or tabBrand NewS$ 10.17 to S$ 45.83Customs services and international tracking providedpawstradinguk (136,121) 99.7%+S$ 36.44 shipping estimatefrom United Kingdom
- StarMark Triple Crown EVERLASTING DOG TREAT Hard Chew CHICKEN MEDIUM 8 TreatsOpens in a new window or tabBrand NewS$ 35.58Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 13.52 postagefrom United StatesAlmost gone17 watchers
- New ListingGood Boy Rice Hide Bonies Bumper Pack of 18 Dog Treat Chew 4 inchOpens in a new window or tabBrand NewS$ 13.43Customs services and international tracking providedpawstradinguk (136,121) 99.7%+S$ 42.11 shipping estimatefrom United Kingdom
- Treat Pleasure Principle (Limited Edition) Japan Music CDOpens in a new window or tabBrand NewS$ 40.83sakura_selections (263) 100%Free International Shippingfrom Japan
- Dried Chicken Fillet Cubes 250g-2kg, 100% Natural Treat for Dogs, Chews JerkyOpens in a new window or tabBrand NewS$ 15.26 to S$ 66.20Customs services and international tracking providednorfolk-feeds (129,991) 99.7%+S$ 42.06 shipping estimatefrom United Kingdom
- Natural Lond Lasting Dog Treat Lamb Skin with FUR Natural Dog Treats Snacks ChewOpens in a new window or tabBrand NewS$ 11.31 to S$ 29.70Customs services and international tracking providedddogtreats (6,383) 100%+S$ 47.05 shipping estimatefrom United Kingdom
- Pointer Peanut Butter Small Bite Bones - Fold Hill Training Snack Reward TreatOpens in a new window or tabBrand NewS$ 10.97 to S$ 67.19Customs services and international tracking providedsuperpet-ltd (212,324) 99.5%+S$ 41.96 shipping estimatefrom United Kingdom
- Freeze Dried Chicken Liver Pet Treats for Dogs and CatsOpens in a new window or tabBrand NewS$ 10.18Top-rated sellerTop-rated sellerhighwellstore (334) 96.6%+S$ 0.91 postagefrom China
- StarMark Triple Crown EVERLASTING DOG TREAT Hard Chew HICKORY SMOKE SM 8 TreatsOpens in a new window or tabBrand NewS$ 23.69Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 9.26 postagefrom United States
- NEW! 3 Flavours -Chicken/Duck/Beef Sausages, Treats, Training Dogs, Snack, ChewsOpens in a new window or tabBrand NewS$ 7.06 to S$ 46.68Customs services and international tracking providedddogtreats (6,383) 100%+S$ 34.43 shipping estimatefrom United Kingdom
- Dried Cow Calves HOOVES Grade A Empty Hoof Pet Treat Chew Dogs Natural Dog TreatOpens in a new window or tabBrand NewS$ 2.70 to S$ 18.49drieddogtreats (13,139) 100%+S$ 24.68 postagefrom United Kingdom
- GENUINE SCOTTISH STAG ANTLER HORN DEER DOG CHEW TREAT 100% ORGANICOpens in a new window or tabBrand NewS$ 11.10 to S$ 31.46thesheffieldcutleryshop (3,786) 100%+S$ 11.10 postagefrom United Kingdom602+ sold
- Meat Filled Hooves Natural Dog Chew Treat - High Protein Healthy Snack - DogOpens in a new window or tabBrand NewS$ 23.56 to S$ 171.35Customs services and international tracking providedplantsparty (4,803) 98.3%+S$ 47.02 shipping estimatefrom United Kingdom
- Mr.Chow's Treats - Pigs Ear Strips - 100% Natural Air-Dried PorkOpens in a new window or tabBrand NewS$ 11.87 to S$ 37.34Customs services and international tracking providedrounceproductslimited (152) 100%+S$ 43.25 shipping estimatefrom United Kingdom
- Natural Balance Limited Ingredient Dog Treats Potato & Duck Formula 14 ozOpens in a new window or tabBrand NewS$ 27.87dealyarddeals (2,007) 97%+S$ 27.20 postagefrom United States
- BULK 160 Pigs Ears - 100% Natural Air-Dried PorkOpens in a new window or tabBrand NewS$ 322.59Customs services and international tracking providedrounceproductslimited (152) 100%+S$ 51.29 shipping estimatefrom United Kingdom
- New ListingAustralian Tazo. The simpsons TV Treats. The Way we WasOpens in a new window or tabPre-OwnedS$ 3.89Top-rated sellerTop-rated sellerwa.cards (13,926) 99.9%+S$ 4.39 postagefrom Australia
- New ListingAustralian Tazo. The simpsons TV Treats. Simpson and DelilahOpens in a new window or tabPre-OwnedS$ 3.89Top-rated sellerTop-rated sellerwa.cards (13,926) 99.9%+S$ 4.39 postagefrom Australia
- StarMark Everlasting Small Dog Treat Hard Chew Chicken Flavored 2-Count - 4-PackOpens in a new window or tabBrand NewS$ 23.69Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 9.26 postagefrom United States82 sold
- MyPets Essentials Chicken Flavour Dog Treats Jerky Fillets Bones Dumbells ChewsOpens in a new window or tabBrand NewS$ 6.77 to S$ 7.62Customs services and international tracking providedcrazy-value-limited (3,622) 98.4%+S$ 47.92 shipping estimatefrom United Kingdom
- New ListingPEDIGREE MARKIES Mini Dog Treats Biscuits (12 x 500g) - 6 kgOpens in a new window or tabBrand NewS$ 59.41Customs services and international tracking providedtasty_foods_inc (1,663) 100%+S$ 92.38 shipping estimatefrom United Kingdom
- Dried Premium Chicken Fillets 250g-2kg, 100% Natural Treat for Dogs, Chews JerkyOpens in a new window or tabBrand NewS$ 15.26 to S$ 66.20Customs services and international tracking providednorfolk-feeds (129,991) 99.7%+S$ 42.06 shipping estimatefrom United Kingdom
- Beef Skin Natural Dog Chew Treat Healthy Snack - Dog Pick and MixOpens in a new window or tabBrand NewS$ 8.63 to S$ 56.57Customs services and international tracking providedplantsparty (4,803) 98.3%+S$ 37.63 shipping estimatefrom United Kingdom
- Antler Dog Chews by Antler Chew Sanded Naturally Shed Long Lasting Dog TreatOpens in a new window or tabBest Price guarantee ! Multi buy save up to 25%Brand NewS$ 7.45 to S$ 45.66Customs services and international tracking providedantlerchew (3,363) 99.8%+S$ 35.25 shipping estimatefrom United Kingdom123+ watchers
- Rabbit Ears Natural with Hair - Hypoallergenic Dog Chew Treat - True DogOpens in a new window or tabBrand NewS$ 30.21Customs services and international tracking providednorfolk-feeds (129,991) 99.7%+S$ 42.87 shipping estimatefrom United Kingdom
- New ListingAustralian Tazo. The simpsons TV Treats. The Call of the Simpsons (bear)Opens in a new window or tabPre-OwnedS$ 3.89Top-rated sellerTop-rated sellerwa.cards (13,926) 99.9%+S$ 4.39 postagefrom Australia
- New ListingAustralian Tazo. The simpsons TV Treats. Oh Brother, Where Art Thou?Opens in a new window or tabPre-OwnedS$ 3.89Top-rated sellerTop-rated sellerwa.cards (13,926) 99.9%+S$ 4.39 postagefrom Australia
- MIX Variety of BESTSELLING small Sausages (3 flavours!) Dog Chews, Treats, petOpens in a new window or tabBrand NewS$ 19.79Customs services and international tracking providedddogtreats (6,383) 100%+S$ 47.61 shipping estimatefrom United Kingdom
- Redbarn Pet Products Filled Bone Natural Chicken & Apple Dog TreatOpens in a new window or tabBrand NewS$ 13.20 to S$ 44.16pet_food_network_online (92,605) 99.8%+S$ 41.61 postagefrom United States
- Buffalo Ears Extra Large XL with Meat 100% Natural Air Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 2.82 to S$ 43.85Customs services and international tracking provided0314stepintopetsworld (45,242) 99%+S$ 41.43 shipping estimatefrom United Kingdom31+ sold
- Dog Calming Chews Hemp Treats Food for Dogs Stress Anxiety Relief Beef 110x UKOpens in a new window or tabBrand NewS$ 18.34Top-rated sellerTop-rated sellerbuyremyhair (22,840) 98.7%+S$ 18.51 postagefrom United Kingdom318 sold
- STAR Treat Soft Chewy Chicken Breast Strips - Treats Dog! easy cut chews jerkyOpens in a new window or tabBrand NewS$ 24.04 to S$ 46.68Customs services and international tracking providedddogtreats (6,383) 100%+S$ 42.79 shipping estimatefrom United Kingdom98+ sold
- Good Boy Soft Meaty Dog Treat Sticks Training Beef Chicken Duck Peanut ButterOpens in a new window or tabBrand NewS$ 3.61 to S$ 20.21Customs services and international tracking provided0314stepintopetsworld (45,242) 99%+S$ 34.50 shipping estimatefrom United Kingdom
- Crunchy Dried Chicken Wings 100% NATURAL - Training Treats for all dog sizesOpens in a new window or tabBrand NewS$ 7.06 to S$ 29.70Customs services and international tracking providedddogtreats (6,383) 100%+S$ 34.43 shipping estimatefrom United Kingdom14+ watchers
- CHICKEN FEET/DUCK FEET NATURAL DOG TREAT/CHEW BUNDLE BOX 100% AIR DRIEDOpens in a new window or tabBrand NewS$ 20.36 to S$ 56.01Customs services and international tracking providedall.natural.pet.foods (614) 99.2%+S$ 42.33 shipping estimatefrom United Kingdom4+ watchers
- New ListingAustralian Tazo. The simpsons TV Treats. Bart the MurdererOpens in a new window or tabPre-OwnedS$ 3.89Top-rated sellerTop-rated sellerwa.cards (13,926) 99.9%+S$ 4.39 postagefrom Australia
- X3 Good Boy Duck Twists - Dog Treat.Opens in a new window or tabBrand NewS$ 18.68Customs services and international tracking providedmonty132009 (4,410) 99.8%+S$ 47.85 shipping estimatefrom United Kingdom
- 100% Low Fat Luxury Lamb Feast Treat Box Natural ICELANDIC Dog Treats 450 g UKOpens in a new window or tabBrand NewS$ 31.44rafkinas (1,478) 100%+S$ 37.00 postagefrom United Kingdom
- 2kg Rabbit Ears Natural with fur Hair Hypoallergenic Dog Treat ChewOpens in a new window or tabBrand NewS$ 67.90Customs services and international tracking providedcricketinnpetandanimalfeeds (2,815) 99.3%+S$ 87.48 shipping estimatefrom United Kingdom60 sold
- Rosewood Hot Dog Sausages Tasty Meat Treat Chicken & Pork 3 x 4 Pack Gluten FreeOpens in a new window or tabBrand NewS$ 19.85Top-rated sellerTop-rated sellerList price: S$ 20.82 5% offCustoms services and international tracking providedhugglepets (258,468) 99.5%+S$ 42.31 shipping estimatefrom United Kingdom12 watchers
- ULTIMATE NATURAL DOG TREAT OSTRICH BILTONG PURE MEAT 100% NATURAL AIR DRIEDOpens in a new window or tabBrand NewS$ 13.57 to S$ 42.43Customs services and international tracking providedall.natural.pet.foods (614) 99.2%+S$ 41.97 shipping estimatefrom United Kingdom1+ watchers
- 2kg Dried Chicken Feet - High Quality 100% Natural Dog Treats - UK ProducedOpens in a new window or tabBrand NewS$ 26.30Customs services and international tracking providedtailwaggertreats (5,213) 99.4%+S$ 46.32 shipping estimatefrom United Kingdom41 watchers
- 100% Natural-Organic Beef Liver Stripes Jerky Air Dried Dog-Pup Treat 300 g UKOpens in a new window or tabBrand NewS$ 22.19rafkinas (1,478) 100%+S$ 31.44 postagefrom United Kingdom6 watchers
- Milk-Bone Brushing Chews Dog Treat Original, LG, 50+Lb, 18 ctOpens in a new window or tabBrand NewS$ 29.41pet_food_network_online (92,605) 99.8%+S$ 41.61 postagefrom United States
- FRUITABLES Skinny Minis Apple Bacon Trainers 12 ounce Treat Pouch for Dogs PetsOpens in a new window or tabBrand NewS$ 23.96Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 9.95 postagefrom United States
- Greenies Original Teenie Size 22 count 6 oz Dental Chew Treats for DogsOpens in a new window or tabBrand NewS$ 19.23Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 9.73 postagefrom United States143 watchers
- Dog Chews Rawhide Chicken flavored Treats x 20Opens in a new window or tabBrand NewS$ 18.25Customs services and international tracking provideddaniel2antoni (16,708) 99.6%+S$ 42.23 shipping estimatefrom United Kingdom
- Dog Treat Reward Magic Bone Filled Twists Raw Hide Free Chicken & Peanut ButterOpens in a new window or tabBrand NewS$ 7.63Customs services and international tracking provided0314stepintopetsworld (45,242) 99%+S$ 34.47 shipping estimatefrom United Kingdom14 watchers
- Pet Munchies Dog Food Training Treats Chew Sushi Venison Duck Chicken-50g -8pcsOpens in a new window or tabBrand NewS$ 24.60Customs services and international tracking providedsafastoresltd_1 (440) 100%+S$ 42.57 shipping estimatefrom United Kingdom
- Pet Freeze Dried Chicken Liver Nutritious Healthy Dog Cat Freeze Dried Treat TtuOpens in a new window or tabBrand NewS$ 12.85Top-rated sellerTop-rated sellertiantianupup (84,563) 98.6%+S$ 0.58 postagefrom China
- Natures Menu Dog Treat Country Hunter Superfood Bar Natural Meat Fish Puppy BarsOpens in a new window or tabBrand NewS$ 11.36 to S$ 37.78Top-rated sellerTop-rated sellerCustoms services and international tracking provided+S$ 49.53 shipping estimatehugglepets (258,468) 99.5%from United Kingdom3+ watchers
- Dried Dog Treats [A171] Chicken Soft Strips with Fish Snack for Dogs Treat ChewsOpens in a new window or tabBrand NewS$ 7.06 to S$ 46.68Customs services and international tracking providedddogtreats (6,383) 100%+S$ 47.97 shipping estimatefrom United Kingdom
- Good Boy Duck Fillets 100% Natural Meat Soft Chew Dog Treat 100g 320g Full BoxOpens in a new window or tabBrand NewS$ 6.78 to S$ 16.82Customs services and international tracking providedpackagepets (67,399) 99%+S$ 34.42 shipping estimatefrom United Kingdom4+ watchers
- Fruitables Deliciously Healthy Dog Treats Pumpkin & Cranberry Flavor 7-OuncesOpens in a new window or tabBrand NewS$ 15.88Top-rated sellerTop-rated sellerlittle.family.members (162,413) 99.1%+S$ 6.49 postagefrom United States
- Natural Raw Dog Training Treats Variety Pack - Duck, Rabbit, and VenisonOpens in a new window or tabBrand NewS$ 22.06Customs services and international tracking providedsapstyle (413) 99.6%+S$ 42.43 shipping estimatefrom United Kingdom
- 100% Organic Vegetarian Dog-Pup Quick Reward Training Treat Natural Fruit 160 gOpens in a new window or tabBrand NewS$ 14.79rafkinas (1,478) 100%+S$ 27.74 postagefrom United Kingdom
- NATURAL FISH TREATS FOR DOGS FISHY GIFT BOX VARIETY TREAT BOX SALMON SQUID HAKEOpens in a new window or tabBrand NewS$ 8.42Customs services and international tracking providedpinionspets01 (57,151) 99.5%+S$ 34.52 shipping estimatefrom United Kingdom26 watchers
- 2x Pet Dog Treat BBQ Grill Chicken Fillets 100% Natural Meat High Protein 075424Opens in a new window or tabBrand NewS$ 22.06Customs services and international tracking providedmyshopuk2020 (6,491) 98.1%+S$ 48.70 shipping estimatefrom United Kingdom
- 10 x Pet Munchies Dog Food Training Treats Liver Chicken Sushi Venison Duck -50gOpens in a new window or tabBrand NewS$ 31.92Customs services and international tracking providedsafastoresltd_1 (440) 100%+S$ 42.96 shipping estimatefrom United Kingdom
- Items Per Page