280,000+ results for treat
- Natural Pet Treats Unlimited Natural Dog Treat Chew Best Norway Selling BrandOpens in a new window or tabBrand NewS$ 6.80 to S$ 44.28Customs services and international tracking providedpawstradinguk (136,077) 99.7%+S$ 31.88 shipping estimatefrom United Kingdom
- Mr.Chow's Treats - Pigs Ear Strips - 100% Natural Air-Dried PorkOpens in a new window or tabBrand NewS$ 11.91 to S$ 37.47Customs services and international tracking providedrounceproductslimited (149) 100%+S$ 39.71 shipping estimatefrom United Kingdom
- Extra Large XL Pigs Ears Dog Treat ChewOpens in a new window or tabBrand NewS$ 25.50 to S$ 49.36Customs services and international tracking providedatipharm619 (282) 100%+S$ 46.65 shipping estimatefrom United Kingdom
- Obedient Aussie Dog Chew Premium Dog Treat Value Pack For All Size DogsOpens in a new window or tabBrand NewS$ 22.18obedient-aussie-dog-chew (19) 100%+S$ 18.09 postagefrom Australia
- New ListingKids Mystery Book Bundle 3 Books, Surprise/treat,Stickers Elementary Boys BooksOpens in a new window or tabPre-OwnedS$ 14.86jeansgreatstuff (98) 100%+S$ 51.05 postagefrom United States
- Fastway Trick Or Treat (CD)Opens in a new window or tabAnother great item from Rarewaves USA | Free delivery!Brand NewS$ 18.15Top-rated sellerTop-rated sellerrarewaves-usa-ca (52,742) 97.7%+S$ 4.31 postagefrom United States
- New ListingWhere Forever Begins by Ken Mellons (CD, 1995) - COUNTRY CD - OZ SELLEROpens in a new window or tabPre-OwnedS$ 11.53Top-rated sellerTop-rated sellertaziedevil (15,924) 99.9%+S$ 23.59 postagefrom Australia
- X3 Good Boy Duck Twists - Dog Treat.Opens in a new window or tabBrand NewS$ 18.74Customs services and international tracking providedmonty132009 (4,402) 99.8%+S$ 44.33 shipping estimatefrom United Kingdom
- Dried Chicken Fillet Cubes 1kg - Natural Treat for Dogs, Premium Jerky, True DogOpens in a new window or tabBrand NewS$ 37.47Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 102.41 shipping estimatefrom United Kingdom
- Dog Treat Bundle - Bakers Rewards (4 Packs), Dog Toy & Extra Strong Waste BagsOpens in a new window or tabBrand NewS$ 19.15Customs services and international tracking providedbp_stores (1,015) 99.3%+S$ 45.22 shipping estimatefrom United Kingdom
- New ListingSLEIGH BELLS TREATS CD 0858275001624 MMPO162Opens in a new window or tabBrand NewS$ 22.27netdiscs (7,755) 99.9%+S$ 15.79 postagefrom United Kingdom
- Dried Chicken Fillet Cubes 250g-2kg, 100% Natural Treat for Dogs, Chews JerkyOpens in a new window or tabBrand NewS$ 15.32 to S$ 66.43Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 38.52 shipping estimatefrom United Kingdom
- Natural Dog Treats 1kg Bulk bags Rabbit Ears, Chicken Feet & Pigs Ears TreatsOpens in a new window or tabBrand NewS$ 36.90 to S$ 38.32Customs services and international tracking providedpetsapply-online (101,710) 99.7%+S$ 32.80 shipping estimatefrom United Kingdom
- Meat Filled Hooves Natural Dog Chew Treat - High Protein Healthy Snack - DogOpens in a new window or tabBrand NewS$ 23.64 to S$ 171.94Customs services and international tracking providedplantsparty (4,762) 98.3%+S$ 43.50 shipping estimatefrom United Kingdom
- WHIMZEES Natural Dental Dog Treats Rice Bone, 50 Count ( pack of 1 )Opens in a new window or tabBrand NewS$ 74.93Customs services and international tracking providedpetcentral2012 (84,670) 99.1%+S$ 89.84 shipping estimatefrom United Kingdom
- 10 x Pet Munchies Dog Food Training Treats Liver Chicken Sushi Venison Duck -50gOpens in a new window or tabBrand NewS$ 32.03Customs services and international tracking providedsafastoresltd_1 (423) 100%+S$ 39.42 shipping estimatefrom United Kingdom
- Natural Dog Treat Selection Pack | 30+ Chew Treats, Pigs Ears, Rabbit, ChickenOpens in a new window or tabBrand NewS$ 19.86 to S$ 42.58Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 23.15 shipping estimatefrom United Kingdom398+ watchers
- Marvel Trading Card Treats - Set of 6. Art by Jim Lee. Impel - 1991Opens in a new window or tabPre-OwnedS$ 5.34Top-rated sellerTop-rated selleral-and-son (2,962) 99.6%+S$ 4.27 postagefrom Canada
- Pet Munchies Salmon Fillets 90g Natural Dog Treat TreatsOpens in a new window or tabBrand NewS$ 14.41Customs services and international tracking providedpawheads (2,469) 99.6%+S$ 38.62 shipping estimatefrom United KingdomAlmost gone2 watchers
- Dried Chicken Fillets 1kg - Natural Treat for Dogs, Premium Jerky, True DogOpens in a new window or tabBrand NewS$ 37.47Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 102.41 shipping estimatefrom United Kingdom42 sold
- Dog Treat Snack Scooby Doggy Chocolate Cacao Free Peanut Butter Pack of 3 x 100gOpens in a new window or tabBrand NewS$ 14.64Customs services and international tracking provideddaniel-prime (1,162) 99.6%+S$ 38.49 shipping estimatefrom United Kingdom
- CHICKEN FEET/DUCK FEET NATURAL DOG TREAT/CHEW BUNDLE BOX 100% AIR DRIEDOpens in a new window or tabBrand NewS$ 20.43 to S$ 56.21Customs services and international tracking providedall.natural.pet.foods (612) 99.2%+S$ 38.79 shipping estimatefrom United Kingdom4+ watchers
- Good Boy Soft Meaty Dog Treat Sticks Training Beef Chicken Duck Peanut ButterOpens in a new window or tabBrand NewS$ 3.62 to S$ 20.27Customs services and international tracking provided0314stepintopetsworld (45,088) 99%+S$ 31.18 shipping estimatefrom United Kingdom
- [500g] A036 Chicken/Lamb Fillets - Crunchy Doggy snacks, chews, treatsOpens in a new window or tabBrand NewS$ 19.86Customs services and international tracking providedddogtreats (6,371) 100%+S$ 44.08 shipping estimatefrom United Kingdom
- 2kg Dried Chicken Feet - High Quality 100% Natural Dog Treats - UK ProducedOpens in a new window or tabBrand NewS$ 26.11Customs services and international tracking providedtailwaggertreats (5,205) 99.4%+S$ 42.78 shipping estimatefrom United Kingdom41 watchers
- DriedDogTreats CHICKEN Dog Treats - Whole range of 100% Natural Dog Snacks TreatOpens in a new window or tabBrand NewS$ 8.50 to S$ 35.48Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 31.06 shipping estimatefrom United Kingdom
- Treat Pleasure Principle (Limited Edition) Japan Music CDOpens in a new window or tabBrand NewS$ 41.29sakura_selections (256) 100%Free International Shippingfrom Japan
- Premium Natural Moist 100% Salmon Skin Roll with Meat Flatties Dog Treat ChewOpens in a new window or tabBrand NewS$ 7.08 to S$ 35.14Customs services and international tracking provided0314stepintopetsworld (45,088) 99%+S$ 38.16 shipping estimatefrom United Kingdom
- KONG Easy Treat Paste LiverOpens in a new window or tabBrand NewS$ 19.42Customs services and international tracking providedholmes-recycled (850) 99.8%+S$ 38.74 shipping estimatefrom United Kingdom
- 2 X Doggie Delights Dog Treat Training Reward Multiple Flavour Beef Chicken DuckOpens in a new window or tabBrand NewS$ 19.58Customs services and international tracking provideddkjcbargains (912) 98.9%+S$ 45.05 shipping estimatefrom United Kingdom
- Wellness WellBars Natural Grain Free Crunchy Dog Treats, Yogurt, Select SizeOpens in a new window or tabBrand NewS$ 51.28dealyarddeals (1,928) 96.7%+S$ 27.43 postagefrom United States
- 3 X Doggie Delights Dog Treat Training Reward Multiple Flavour Beef Chicken DuckOpens in a new window or tabBrand NewS$ 25.47Customs services and international tracking provideddkjcbargains (912) 98.9%+S$ 45.35 shipping estimatefrom United Kingdom
- StarMark Everlasting Dog Treat Toy Bacon Edible Dental Chew MediumOpens in a new window or tabBrand NewS$ 14.57Top-rated sellerTop-rated sellerList price: S$ 14.85 2% offlittle.family.members (162,347) 99.1%+S$ 7.55 postagefrom United States16 sold
- BESTSELLER!!! Chicken Wrapped Jerky Beef Twists Dog Treat Chews 10pieces RawhideOpens in a new window or tabBrand NewS$ 7.08 to S$ 46.84Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 44.45 shipping estimatefrom United Kingdom64+ sold
- GoodBoy Pawsley Chicken Fillet Dog Treat 320gOpens in a new window or tabBrand NewS$ 17.02Customs services and international tracking providedthepetsuperstore (26,345) 99.8%+S$ 52.76 shipping estimatefrom United Kingdom
- Coffee Wood Dog Chew Natural Vegan Chewing Stick Dental Care Training TreatOpens in a new window or tabBrand NewS$ 9.92 to S$ 21.28Customs services and international tracking provided**vetfleece** (22,251) 98.9%+S$ 22.69 shipping estimatefrom United Kingdom
- 5"-6" Natural Dog Chew Treat Meaty Beef Marrow Shank BoneOpens in a new window or tabBrand NewS$ 14.85ovadeks (2,624) 100%+S$ 44.15 postagefrom United States
- 48HR TRACKED Hollow Calcium Bones - Dog Treat Empty Beef Sterilised White BoneOpens in a new window or tabBrand NewS$ 8.50 to S$ 14.18Customs services and international tracking provided0314stepintopetsworld (45,088) 99%+S$ 44.67 shipping estimatefrom United Kingdom
- Terahertz Cell Detoxification Wand (Boost Health, Treat Illness & Disease) UKOpens in a new window or tabBrand NewS$ 161.85Customs services and international tracking providedpts333 (2,247) 100%+S$ 52.68 shipping estimatefrom United Kingdom
- Obedient Aussie Dog Chew Premium Dog Treat XXL Pack For Dogs over 32kgOpens in a new window or tabBrand NewS$ 24.11obedient-aussie-dog-chew (19) 100%+S$ 18.09 postagefrom Australia
- Dried Premium Chicken Fillets 250g-2kg, 100% Natural Treat for Dogs, Chews JerkyOpens in a new window or tabBrand NewS$ 15.32 to S$ 66.43Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 38.52 shipping estimatefrom United Kingdom
- Monster mini chocolate jazzles treat/reward for dogs - 100% safe for dogs 130gOpens in a new window or tabBrand NewS$ 5.54Customs services and international tracking providedpetcentre2016 (84,946) 99.2%+S$ 30.70 shipping estimatefrom United Kingdom23 watchers
- Good Boy Duck Fillets 100% Natural Meat Soft Chew Dog Treat 100g 320g Full BoxOpens in a new window or tabBrand NewS$ 6.80 to S$ 16.88Customs services and international tracking providedpackagepets (67,320) 99%+S$ 30.85 shipping estimatefrom United Kingdom4+ watchers
- 2kg Dried Chicken Necks - High Quality 100% Natural Dog TreatsOpens in a new window or tabBrand NewS$ 26.11Customs services and international tracking providedtailwaggertreats (5,205) 99.4%+S$ 42.78 shipping estimatefrom United Kingdom41 watchers
- ULTIMATE NATURAL DOG TREAT OSTRICH BILTONG PURE MEAT 100% NATURAL AIR DRIEDOpens in a new window or tabBrand NewS$ 13.61 to S$ 42.58Customs services and international tracking providedall.natural.pet.foods (612) 99.2%+S$ 38.44 shipping estimatefrom United Kingdom11+ sold
- Pointer Peanut Butter Small Bite Bones - Fold Hill Training Snack Reward TreatOpens in a new window or tabBrand NewS$ 11.00 to S$ 67.43Customs services and international tracking providedsuperpet-ltd (212,028) 99.5%+S$ 38.50 shipping estimatefrom United Kingdom
- Monster Mixed chocolate mice treat/reward for dogs - 100% safe for dogs 130gOpens in a new window or tabBrand NewS$ 5.54Customs services and international tracking providedpetcentre2016 (84,946) 99.2%+S$ 30.70 shipping estimatefrom United Kingdom132 watchers
- Premium Rabbit Skin Rolls with Fur (15cm) 200g 6 Units - All-Natural Dog TreatsOpens in a new window or tabBrand NewS$ 15.32Customs services and international tracking providedsapstyle (410) 99.6%+S$ 22.69 shipping estimatefrom United Kingdom
- StarMark Everlasting Small Dog Treat Hard Chew Chicken Flavored 2-Count - 4-PackOpens in a new window or tabBrand NewS$ 23.89Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 9.34 postagefrom United States82 sold
- 100% Natural-Organic Beef Liver Stripes Jerky Air Dried Dog-Pup Treat 300 g UKOpens in a new window or tabBrand NewS$ 22.27rafkinas (1,467) 100%+S$ 31.55 postagefrom United Kingdom
- True Dog Fish Skin Fingers - 100% Fish Jerky - Natural Dog TreatOpens in a new window or tabBrand NewS$ 15.32 to S$ 132.87Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 38.52 shipping estimatefrom United Kingdom
- Bakers Dog Food Rewards Variety Beef Chicken Lamb Treat Tasty Snack x 6 Packs!Opens in a new window or tabBrand NewS$ 17.00Customs services and international tracking providedxl-supply (5,281) 99.6%+S$ 38.62 shipping estimatefrom United Kingdom
- Pet Freeze Dried Chicken Liver Nutritious Healthy Dog Cat Freeze Dried Treat ForOpens in a new window or tabBrand NewS$ 10.92Top-rated sellerTop-rated sellerbinggoshop (40,229) 98.6%+S$ 0.91 postagefrom China12 watchers
- Daryl Haywood Combo - You Treat Me Like A No Good! (CD) - Revival Rock & Roll...Opens in a new window or tabBrand NewS$ 32.18bear_family_records (51,864) 99.6%+S$ 4.46 postagefrom Germany
- Wagg Yumms Liver Dog Treats, 400 g Pack of 5Opens in a new window or tabBrand NewS$ 15.18Customs services and international tracking providedgeordie1010 (754) 98.4%+S$ 52.66 shipping estimatefrom United KingdomLast one1 watchers
- 2kg Rabbit Ears Natural with fur Hair Hypoallergenic Dog Treat ChewOpens in a new window or tabBrand NewS$ 68.13Customs services and international tracking providedcricketinnpetandanimalfeeds (2,811) 99.3%+S$ 84.10 shipping estimatefrom United Kingdom60 sold
- Hide Free Zero Hide Low Fat Donut Ring Rings Chicken Peanut Butter Dog TreatOpens in a new window or tabBrand NewS$ 5.66 to S$ 17.82Customs services and international tracking provided0314stepintopetsworld (45,088) 99%+S$ 31.09 shipping estimatefrom United Kingdom
- Triple Dog Natural Treat Box for Three Dogs Chews Real Meat Classic SnacksOpens in a new window or tabBrand NewS$ 18.87Customs services and international tracking providedplantsparty (4,762) 98.3%+S$ 38.91 shipping estimatefrom United Kingdom
- 100% Natural Dog Treat Bag - Mixed Chews/Treat Assortment Great For EasterOpens in a new window or tabBrand NewS$ 15.76Customs services and international tracking providedlilliput696 (1,580) 99.4%+S$ 38.56 shipping estimatefrom United Kingdom
- Bonio original 1kg - large plain healthy bone shaped dog biscuits - treat/rewarOpens in a new window or tabBrand NewS$ 12.78Customs services and international tracking providedpetcentre2016 (84,946) 99.2%+S$ 38.39 shipping estimatefrom United Kingdom26 watchers
- DriedDogTreats [500g] Hen/Cod Fillets Crunchy Doggy Snacks Chews Treats ChickenOpens in a new window or tabBrand NewS$ 24.09Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 39.25 shipping estimatefrom United Kingdom
- Bakers Whirlers Bacon and Cheese Double Flavour Twisted Dog Treat 6 x 130gOpens in a new window or tabBrand NewS$ 17.00Customs services and international tracking providedxl-supply (5,281) 99.6%+S$ 44.91 shipping estimatefrom United Kingdom97 sold
- Natural Icelandic Air Dried Cod Fish Skin Fingers Vitamin Source Dog Treat 300 gOpens in a new window or tabBrand NewS$ 22.27rafkinas (1,467) 100%+S$ 27.84 postagefrom United Kingdom
- Treat - Same CD #G16468Opens in a new window or tabPre-OwnedS$ 33.28tws-music (58,489) 99.3%+S$ 12.69 postagefrom Germany
- GOOD BOY MEGA CHEWY TWISTS WITH DUCK 70G DOG CHEW NATURAL TREATS CASE OF 18Opens in a new window or tabBrand NewS$ 42.58Customs services and international tracking provideddiverseretail (12,245) 99.8%+S$ 76.16 shipping estimatefrom United KingdomLast one1 watchers
- Pointer Milky Cheesy Bones Small Bite Mini Dog Treat Reward Puppy Adult TrainingOpens in a new window or tabBrand NewS$ 11.15 to S$ 68.14Customs services and international tracking providedsuperpet-ltd (212,028) 99.5%+S$ 44.81 shipping estimatefrom United Kingdom
- Dried Dog Treats [A171] Chicken Soft Strips with Fish Snack for Dogs Treat ChewsOpens in a new window or tabBrand NewS$ 7.08 to S$ 42.58Customs services and international tracking providedddogtreats (6,371) 100%+S$ 44.45 shipping estimatefrom United Kingdom
- Natural Rabbit Ears with Fur 2kg | Hypoallergenic Dog Chew Treat @rawdogfoodukOpens in a new window or tabBrand NewS$ 74.96Customs services and international tracking providedrawdogfooduk (91) 100%+S$ 77.43 shipping estimatefrom United Kingdom
- 100% Low Fat Luxury Lamb Feast Treat Box Natural ICELANDIC Dog Treats 450 g UKOpens in a new window or tabBrand NewS$ 31.55rafkinas (1,467) 100%+S$ 37.12 postagefrom United Kingdom
- 100% Natural Healthy Dried Duck Necks Dog Treat Treats Joint Aid GlucosamineOpens in a new window or tabBrand NewS$ 4.25 to S$ 19.10Customs services and international tracking provided0314stepintopetsworld (45,088) 99%+S$ 44.26 shipping estimatefrom United Kingdom6+ watchers
- 100% Natural Dog Treats Letterbox - Mixed Dog Chews & Treats Small Dog - EasterOpens in a new window or tabBrand NewS$ 13.61Customs services and international tracking providedlilliput696 (1,580) 99.4%+S$ 38.44 shipping estimatefrom United Kingdom
- Mini Cod Skin Cubes 100% Natural Dog Treats Pure Organic Air Dried Fish 300 g UKOpens in a new window or tabBrand NewS$ 27.84rafkinas (1,467) 100%+S$ 27.84 postagefrom United Kingdom
- 500g Beef Liver Training Treats Jerky 100% Natural Dried Dog Treat Small DogsOpens in a new window or tabBrand NewS$ 22.70Customs services and international tracking providedddogtreats (6,371) 100%+S$ 45.46 shipping estimatefrom United Kingdom
- Chicken Lamb Duck Beef Jerky Sticks 100% Natural Dog Treats Dog Chews Dog SnacksOpens in a new window or tabBrand NewS$ 8.50 to S$ 32.64Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 31.95 shipping estimatefrom United Kingdom22+ watchers
- BESTSELLER!!!! Soft Chicken/Duck Thin Sticks - treats snacks chews 10-15 pcsOpens in a new window or tabBrand NewS$ 7.08 to S$ 46.84Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 30.87 shipping estimatefrom United Kingdom91+ sold
- FRUITABLES Skinny Minis Apple Bacon Trainers 12 ounce Treat Pouch for Dogs PetsOpens in a new window or tabBrand NewS$ 24.16Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 10.03 postagefrom United States
- Pointer Peanut Butter Paws Pets Dogs Treat Biscuits Crunchy Oven Baked CookiesOpens in a new window or tabBrand NewS$ 10.72 to S$ 70.97Customs services and international tracking providedsuperpet-ltd (212,028) 99.5%+S$ 38.40 shipping estimatefrom United Kingdom
- Pack Of 2 or 4 Roasted Pork Flavour Bones 20cm Large Dog Chew Treat Real MeatOpens in a new window or tabBrand NewS$ 11.34 to S$ 16.97Top-rated sellerTop-rated sellerCustoms services and international tracking provided+S$ 31.14 shipping estimateyoureverydaystuff (207,465) 99.1%from United Kingdom87+ sold
- Nylabone Healthy Edibles All-Natural Peanut Butter Chew Treat For Large DogsOpens in a new window or tabBrand NewS$ 19.40Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 9.26 postagefrom United States
- Whimzees Rice Bone 9 Pack - Natural Vegetable Dental Chew Treat Gluten Free XmasOpens in a new window or tabBrand NewS$ 17.02Customs services and international tracking providedsuperpet-ltd (212,028) 99.5%+S$ 38.79 shipping estimatefrom United Kingdom149 sold
- CHEWY CHICKEN FILLETS 80G GOOD BOY DOG PUPPY TREATS NATURAL MEAT CHEW CASE OF 10Opens in a new window or tabBrand NewS$ 34.77Customs services and international tracking provideddiverseretail (12,245) 99.8%+S$ 75.66 shipping estimatefrom United Kingdom
- [100g] Mini Rolls with Chicken/Cod, Tasty snacks Treats Training Treat 25-30pcsOpens in a new window or tabBrand NewS$ 7.07Customs services and international tracking providedddogtreats (6,371) 100%+S$ 30.87 shipping estimatefrom United Kingdom496 sold
- Good Boy Pawsley Jumbo Chicken Twist 100% Natural Meaty Dog Chew Treat Low-FatOpens in a new window or tabBrand NewS$ 7.79 to S$ 48.26Customs services and international tracking providedpackagepets (67,320) 99%+S$ 30.91 shipping estimatefrom United Kingdom
- Dried Dog Treats BESTSELLING Chicken Small DOG CHEWS - Treats, Snacks, Pet FoodOpens in a new window or tabBrand NewS$ 24.12Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 45.54 shipping estimatefrom United Kingdom
- Wagg Yumms Liver Dog Treats 400g Pack Of 5 Treat Biscuits Dog PuppyOpens in a new window or tabBrand NewS$ 14.60Customs services and international tracking providedjack_trades_all (1,010) 96.5%+S$ 38.49 shipping estimatefrom United KingdomLast one4 watchers
- Good Boy Pawsley Chewy Bones With Chicken 80g Dog Chew Treat 100% Natural MeatOpens in a new window or tabBrand NewS$ 6.80 to S$ 14.75Customs services and international tracking providedpackagepets (67,320) 99%+S$ 31.37 shipping estimatefrom United Kingdom30+ sold
- Chicken & Rice Dog Treat Sticks 3 X 220g Value Pack Good Boy ChewsOpens in a new window or tabBrand NewS$ 18.72Customs services and international tracking providedwickedgenius13 (1,361) 100%+S$ 38.71 shipping estimatefrom United Kingdom
- Rabbit Ears Natural with Fur | Hypoallergenic Dog Chew Treat | True DogOpens in a new window or tabBrand NewS$ 13.61 to S$ 66.43Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 38.44 shipping estimatefrom United Kingdom
- GOODBOY 70G MEGA CHEWY TWIST WITH CHICKEN DOG CHEW NATURAL TREAT 5 OR 10 PACKOpens in a new window or tabBrand NewS$ 26.25Customs services and international tracking provideddiverseretail (12,245) 99.8%+S$ 39.39 shipping estimatefrom United Kingdom5+ watchers
- Dried Dog Treats A132 Fish & Chicken Soft Roll-Up Jerky Chewy Treats NaturalOpens in a new window or tabBrand NewS$ 7.08 to S$ 42.58Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 44.45 shipping estimatefrom United Kingdom
- Natural Rabbit Ears with Fur 40pk | Hypoallergenic Dog Chew Treat | True DogOpens in a new window or tabBrand NewS$ 30.31Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 39.34 shipping estimatefrom United Kingdom37 watchers
- Fold Hill Pointer Chicken Gravy Bones Dog Biscuit Treat Food Complimentary SnackOpens in a new window or tabBrand NewS$ 7.08 to S$ 42.58Customs services and international tracking providedpackagepets (67,320) 99%+S$ 30.87 shipping estimatefrom United Kingdom
- DriedDogTreats [100g] Pick 'n' Mix Variety of Treats Selection of Chews for DOGSOpens in a new window or tabBrand NewS$ 5.66Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 32.46 shipping estimatefrom United Kingdom
- Pizzle Stick 6" Wrapped In Biltong Natural Dog Chew Treat Bully StickOpens in a new window or tabBrand NewS$ 22.13Customs services and international tracking providedkcpettreats (3,145) 99.8%+S$ 38.90 shipping estimatefrom United Kingdom
- N-Bone Puppy Teething Ring Pum PKin Delicious Low Fat Puppies Chew Treats 6 PKOpens in a new window or tabBrand NewS$ 21.27Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 9.65 postagefrom United States
- winalot shapes 1kg dog biscuits - multi shapes/coloured treat/reward - brandedOpens in a new window or tabBrand NewS$ 11.93Customs services and international tracking providedpetcentre2016 (84,946) 99.2%+S$ 38.35 shipping estimatefrom United KingdomAlmost gone18 watchers
- Jr Pure Training Treats 100% Natural Treats For Dogs Duck x3 85g Gluten FreeOpens in a new window or tabBrand NewS$ 26.41Customs services and international tracking providedhealthy-mutts (5,814) 99.6%+S$ 39.12 shipping estimatefrom United Kingdom
- Good Boy Pawsley Chewy Chicken Fillets Dog Treats Jerky Meat Dental Chews 320gOpens in a new window or tabBrand NewS$ 17.02Customs services and international tracking providedpurelypetsupplies (105,606) 99%+S$ 45.08 shipping estimatefrom United Kingdom
- Pets Unlimited Dog Treats Meaty Grain-Free Dog Treats Natural Treats for DogsOpens in a new window or tabBrand NewS$ 7.79 to S$ 11.91Customs services and international tracking providedpackagepets (67,320) 99%+S$ 38.20 shipping estimatefrom United Kingdom1+ watchers
- Greenies Original Teenie Size 22 count 6 oz Dental Chew Treats for DogsOpens in a new window or tabBrand NewS$ 19.38Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 9.81 postagefrom United States143 watchers
- Bonio fibre biscuits 1 kg - health high fibre dog biscuits/treat/rewardOpens in a new window or tabBrand NewS$ 12.78Customs services and international tracking providedpetcentre2016 (84,946) 99.2%+S$ 38.39 shipping estimatefrom United Kingdom24 watchers
- 100% Natural Fruit Dog-Pup Treat Vegetarian Training Quick Reward Treat 160 gOpens in a new window or tabBrand NewS$ 14.84rafkinas (1,467) 100%+S$ 31.55 postagefrom United Kingdom
- XL Deer Legs with Fur 100% Natural Air-Dried Treat for dogs Long LastingOpens in a new window or tabBrand NewS$ 21.28 to S$ 106.47Customs services and international tracking providedexpress-pet-supplies-uk (63,781) 99.8%+S$ 39.07 shipping estimatefrom United Kingdom10+ watchers
- 👉Good Boy Dog Treats Mega Chicken With Carrot Stick/ Chewy Twist With Duck PK 3Opens in a new window or tabBrand NewS$ 11.34 to S$ 59.62Customs services and international tracking providedttsonlinestore (15,008) 99.5%+S$ 38.44 shipping estimatefrom United Kingdom
- 100% Natural Air Dried Chicken Necks Dog Treats Healthy Joints Chondroitin 120gOpens in a new window or tabBrand NewS$ 7.08Customs services and international tracking provided0314stepintopetsworld (45,088) 99%+S$ 44.45 shipping estimatefrom United Kingdom
- Pointer COBS WITH CHARCOAL Dog Biscuits Snacks Food Healthy Treat 50g-1KGOpens in a new window or tabBrand NewS$ 4.23 to S$ 30.63Customs services and international tracking provideddavies9233 (12,529) 98.2%+S$ 30.63 shipping estimatefrom United Kingdom
- 1 Kg Bargain Bulk Bag Buys Natural Dog Treat Chews Chicken wings Necks Rabbit eaOpens in a new window or tabBrand NewS$ 22.47 to S$ 46.84Customs services and international tracking providedfureverpetsco (11,760) 99%+S$ 44.96 shipping estimatefrom United Kingdom
- Milk chocolate monster fish and chips treats for dogs 130g - treat/rewardOpens in a new window or tabBrand NewS$ 5.54Customs services and international tracking providedpetcentre2016 (84,946) 99.2%+S$ 30.70 shipping estimatefrom United Kingdom35 watchers
- SOOPA Healthy Bites Natural Low Fat Dog Treats - CHOOSE FLAVOUR/MULTIBUY SAVINGOpens in a new window or tabBrand NewS$ 7.65 to S$ 57.89Customs services and international tracking providedgreencocouk (2,423) 100%+S$ 44.40 shipping estimatefrom United Kingdom
- DOG POPCORN TREAT BOX, 3 FLAVOURS, MULTIPACK BOX BIRTHDAY PRESENT TRAININGOpens in a new window or tabBrand NewS$ 13.63Customs services and international tracking providedbarry3027 (1,186) 100%+S$ 38.44 shipping estimatefrom United Kingdom
- Fish skin (Flatties) a natural dog treat made from 100% fish. 200g 15 + strips.Opens in a new window or tabBrand NewS$ 22.13Customs services and international tracking providedsapstyle (410) 99.6%+S$ 23.07 shipping estimatefrom United Kingdom
- Nova 1kg Bulk Bag Hairless Light Lamb Skin Natural Dog TreatsOpens in a new window or tabBrand NewS$ 32.35Customs services and international tracking providedfureverpetsco (11,760) 99%+S$ 39.44 shipping estimatefrom United Kingdom
- StarMark Everlasting Small Dog Treat Hard Dental Chew Chicken Flavored 2-CountOpens in a new window or tabBrand NewS$ 12.06Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 6.59 postagefrom United States
- StarMark Everlasting Dog Treat Toy Bacon Edible Dental Chew Small - 4 PackOpens in a new window or tabBrand NewS$ 24.50Top-rated sellerTop-rated sellerlittle.family.members (162,347) 99.1%+S$ 8.38 postagefrom United States
- Pointer CHEESE FLAVOURED BONES Dog Biscuits Snack Food Treat Puppy Adult 50g-1KGOpens in a new window or tabBrand NewS$ 4.23 to S$ 30.63Customs services and international tracking provideddavies9233 (12,529) 98.2%+S$ 32.06 shipping estimatefrom United Kingdom
- Pet Center Quakers Duck Breast Fillets Treat Slow Roasted Low-Fat Chew Food 3 ozOpens in a new window or tabBrand NewS$ 14.05Top-rated sellerTop-rated sellerList price: S$ 15.80 11% offlittle.family.members (162,347) 99.1%+S$ 7.19 postagefrom United States
- Dog Calming Chews Hemp Treats Food for Dogs Stress Anxiety Relief Beef 110x UKOpens in a new window or tabBrand NewS$ 18.40Top-rated sellerTop-rated sellerbuyremyhair (22,809) 98.7%+S$ 18.57 postagefrom United Kingdom316 sold
- NATURAL TREATS FOR DOGS GIFT BOX VARIETY TREAT BOX CHICKEN DUCK BEEF RABBIT DEEROpens in a new window or tabBrand NewS$ 8.45Customs services and international tracking providedpinionspets01 (57,084) 99.5%+S$ 30.96 shipping estimatefrom United Kingdom133 watchers
- Freeze Dried Chicken High Nutrient Content Cat Freeze Dried Treat For Dogs C GflOpens in a new window or tabBrand NewS$ 14.04Top-rated sellerTop-rated sellergoodfeeling100 (28,828) 98.7%+S$ 0.91 postagefrom ChinaLast one18 watchers
- DriedDogTreats XXL Pork Pig Ears 100% Natural Pork Treats Dogs Large Treat SnackOpens in a new window or tabBrand NewS$ 8.50 to S$ 28.38Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 30.96 shipping estimatefrom United Kingdom
- Camel Headskin Dog Treat Scalp Slices 100% Natural Air Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 8.50 to S$ 36.90Customs services and international tracking providedexpress-pet-supplies-uk (63,781) 99.8%+S$ 40.09 shipping estimatefrom United Kingdom
- Dried Pigs Inner Ear 250g-2kg, 100% Natural Treat for Dogs, Pork Crunchy BitesOpens in a new window or tabBrand NewS$ 11.91 to S$ 32.35Customs services and international tracking providednorfolk-feeds (129,637) 99.7%+S$ 38.35 shipping estimatefrom United Kingdom
- DriedDogTreats Buffalo Chicken Fillets/Crunchy Doggy Snacks Chews, Treats, JerkyOpens in a new window or tabBrand NewS$ 24.12Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 39.25 shipping estimatefrom United Kingdom
- Triple Treat, Vol. 3 by Monty Alexander (CD, Dec-1989, Concord)Opens in a new window or tabBrand NewS$ 56.49dahug-4199 (704) 100%+S$ 36.26 postagefrom United States
- Taster Bundle Natural Dog Treat Box Pate Lamb Chicken Beef Pork Goat ChewsOpens in a new window or tabBrand NewS$ 30.65Customs services and international tracking providedfureverpetsco (11,760) 99%+S$ 39.36 shipping estimatefrom United Kingdom
- 500g BAGS PURE PIG EAR STRIPS 100% NATURAL TASTY TREAT REWARD Best QualityOpens in a new window or tabBrand NewS$ 15.15Customs services and international tracking providedtongmaster-seasonings (108,451) 99.7%+S$ 24.38 shipping estimatefrom United Kingdom106 sold
- Beef Jerky - Puffed Lung Natural Dog Chew Treat Meaty Healthy Snack - Dog PickOpens in a new window or tabBrand NewS$ 7.81 to S$ 45.72Customs services and international tracking providedplantsparty (4,762) 98.3%+S$ 31.23 shipping estimatefrom United Kingdom
- Nutrient-Rich Freeze Dried Chicken Treat for Dogs - Boost Health VitalityOpens in a new window or tabBrand NewS$ 13.80Top-rated sellerTop-rated sellertopstoreshop21 (9,253) 98.3%+S$ 0.91 postagefrom China
- Pointer PEANUT BUTTER SMALL BITES BONES Dog Biscuits Food Healthy Treat 50g-1KGOpens in a new window or tabBrand NewS$ 4.23 to S$ 30.63Customs services and international tracking provideddavies9233 (12,529) 98.2%+S$ 31.23 shipping estimatefrom United Kingdom
- N-Bone Puppy Teething Ring - Pumpkin Flavor Treat for PuppiesOpens in a new window or tabBrand NewS$ 8.84 to S$ 19.25pet_food_network_online (92,502) 99.8%+S$ 41.95 postagefrom United States
- DriedDogTreats [100g] Thin Sticks Chicken Snacks Chews Treats Healthy TrainingOpens in a new window or tabBrand NewS$ 7.08Customs services and international tracking provideddrieddogtreats (13,117) 100%+S$ 30.87 shipping estimatefrom United Kingdom190 sold
- 20x Meat Filled Hooves - High Quality Natural Dog TreatsOpens in a new window or tabBrand NewS$ 24.41Customs services and international tracking providedtailwaggertreats (5,205) 99.4%+S$ 42.66 shipping estimatefrom United Kingdom110 sold
- Pointer Charcoal Cobs Crunchy Biscuit Treat Dog Training Healthy DigestionOpens in a new window or tabBrand NewS$ 4.65 to S$ 85.02Customs services and international tracking providednorthern.angling.supplies (38,248) 94.8%+S$ 30.75 shipping estimatefrom United Kingdom
- Antler Dog Chews by Antler Chew Sanded Naturally Shed Long Lasting Dog TreatOpens in a new window or tabBest Price guarantee ! Multi buy save up to 25%Brand NewS$ 7.48 to S$ 45.81Customs services and international tracking providedantlerchew (3,359) 99.8%+S$ 32.87 shipping estimatefrom United Kingdom167+ sold
- Hollow Cow Hooves Natural Dog Chew Treat Healthy Snack - Dog Pick and MixOpens in a new window or tabBrand NewS$ 18.10 to S$ 108.97Customs services and international tracking providedplantsparty (4,762) 98.3%+S$ 44.72 shipping estimatefrom United Kingdom
- Items Per Page