48,000+ results for treat
- Obedient Aussie Dog Chew Premium Dog Treat XXL Pack For Dogs over 32kgOpens in a new window or tabBrand NewS$ 24.50+S$ 18.38 postagefrom Australiaobedient-aussie-dog-chew (19) 100%
- New ListingDog Treats Various - All Brand NewOpens in a new window or tabBrand NewS$ 8.45+S$ 53.26 shipping estimatefrom United KingdomCustoms services and international tracking providedstephanismit_96 (149) 100%
- New ListingPet Safe Treat Holding Cactus For DogsOpens in a new window or tabBrand NewS$ 8.79+S$ 66.25 postagefrom United Statesmidwestemporium (784) 99.7%
- BESTSELLER!!! Chicken Wrapped Jerky Beef Twists Dog Treat Chews 10pieces RawhideOpens in a new window or tabBrand NewS$ 7.10 to S$ 46.95+S$ 48.24 shipping estimatefrom United Kingdom64+ soldCustoms services and international tracking provideddrieddogtreats (13,202) 100%
- Rabbit Ears Natural with Hair - Hypoallergenic Dog Chew Treat - True DogOpens in a new window or tabBrand NewS$ 13.64 to S$ 68.29+S$ 42.21 shipping estimatefrom United KingdomCustoms services and international tracking providednorfolk-feeds (130,807) 99.7%
- New ListingHiLife CHEWS DAY! Dog Treat - Seasonal Dog Chews, 20 Chews Shape VariesOpens in a new window or tabBrand NewS$ 46.87+S$ 86.82 shipping estimatefrom United KingdomFree returnsCustoms services and international tracking providede-bouti-que (42) 95.8%
- Bonio original 1kg - large plain healthy bone shaped dog biscuits - treat/rewarOpens in a new window or tabBrand NewS$ 12.81+S$ 42.16 shipping estimatefrom United KingdomAlmost gone26 watchersCustoms services and international tracking providedpetcentre2016 (85,137) 99.2%
- Natural Lond Lasting Dog Treat Lamb Skin with FUR Natural Dog Treats Snacks ChewOpens in a new window or tabBrand NewS$ 11.37 to S$ 29.87+S$ 47.32 shipping estimatefrom United KingdomCustoms services and international tracking providedddogtreats (6,425) 100%
- DOG POPCORN TREAT BOX, 3 FLAVOURS, MULTIPACK BOX BIRTHDAY PRESENT TRAININGOpens in a new window or tabBrand NewS$ 13.66+S$ 42.21 shipping estimatefrom United KingdomCustoms services and international tracking providedbarry3027 (1,187) 100%
- Chicken Poultry Mini Jerky Sticks 100% Natural Dog Treats Dog Snacks Dog ChewsOpens in a new window or tabBrand NewS$ 9.24 to S$ 27.02+S$ 42.08 shipping estimatefrom United Kingdom73+ soldCustoms services and international tracking provideddrieddogtreats (13,202) 100%
- X3 Good Boy Duck Twists - Dog Treat.Opens in a new window or tabBrand NewS$ 18.78+S$ 48.12 shipping estimatefrom United KingdomCustoms services and international tracking providedmonty132009 (4,427) 99.8%
- Seachem KanaPlex Treats Fungal and Bacterial Fish Diseases - 5 grams (0.18oz)Opens in a new window or tabBrand NewS$ 19.36List price: S$ 21.7511% off+S$ 2.20 postagefrom United States177 watchersTop-rated sellerTop-rated sellerlittle.family.members (162,542) 99.1%
- Dried Duck Flaps - BESTSELLING Duck Hard Chew! Great Treat for All Dog Size!!Opens in a new window or tabBrand NewS$ 7.10 to S$ 46.95+S$ 34.63 shipping estimatefrom United Kingdom61+ soldCustoms services and international tracking providedddogtreats (6,425) 100%
- Buffalo Pizzles Dog Treat 100% Natural Chew Express Pet Supplies High in ProteinOpens in a new window or tabBrand NewS$ 22.75 to S$ 92.48+S$ 49.25 shipping estimatefrom United KingdomCustoms services and international tracking providedexpress-pet-supplies-uk (63,898) 99.8%
- CHICKEN NECKS NATURAL DOG TREAT GLUTEN FREE AIR DRIED 10 PACKOpens in a new window or tabBrand NewS$ 7.10+S$ 34.63 shipping estimatefrom United KingdomCustoms services and international tracking providedpinionspets01 (57,262) 99.5%
- New Listing2x300g Garfield Supremies | Salmon | Chicken & Cheese | Crunchy Treat BiscuitsOpens in a new window or tabBrand NewS$ 20.41+S$ 40.21 shipping estimatefrom United KingdomCustoms services and international tracking provideddantomlinson (167) 100%
- Pet Cat Dog Tumbler Feeder Leakage Food Dispenser Treat Ball Mice Toy USOpens in a new window or tabBrand NewS$ 4.09Free International Shippingfrom ChinaTop-rated sellerTop-rated sellerjoreal (2,574) 98%
- Bakers Whirlers Bacon and Cheese Double Flavour Twisted Dog Treat 6 x 130gOpens in a new window or tabBrand NewS$ 17.04+S$ 48.70 shipping estimatefrom United Kingdom111 soldCustoms services and international tracking providedxl-supply (5,908) 99.6%
- Redbarn Pet Products Bully Stick Dog Treat, 5 Inch (3- Pack)Opens in a new window or tabBrand NewS$ 21.91+S$ 25.67 postagefrom United Statespet_food_network_online (92,786) 99.8%
- Three Bird DUCK CHICKEN TURKEY Natural Dog Training Quick Reward Treat 200 g UKOpens in a new window or tabBrand NewS$ 18.58+S$ 31.62 postagefrom United Kingdomrafkinas (1,505) 100%
- Pizzle Stick pieces 500g Natural Dog Chew Treat Bully Stick OffcutsOpens in a new window or tabBrand NewS$ 27.31+S$ 42.95 shipping estimatefrom United KingdomCustoms services and international tracking providedkcpettreats (3,164) 99.8%
- Pizzle Stick 10" (26cm) Pack Of 5 Natural Dog Chew Treat Bully StickOpens in a new window or tabBrand NewS$ 29.01+S$ 43.03 shipping estimatefrom United KingdomCustoms services and international tracking providedkcpettreats (3,164) 99.8%
- Thick Bulls Pizzle 1kg Chunky Bully Stick 100% Naturally Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 78.53+S$ 88.52 shipping estimatefrom United KingdomCustoms services and international tracking providedkcpettreats (3,164) 99.8%
- Pointer Peanut Butter Small Bite Bones - Fold Hill Training Snack Reward TreatOpens in a new window or tabBrand NewS$ 11.03 to S$ 67.58+S$ 42.20 shipping estimatefrom United KingdomCustoms services and international tracking providedsuperpet-ltd (212,828) 99.5%
- NEW! 3 Flavours -Chicken/Duck/Beef Sausages, Treats, Training Dogs, Snack, ChewsOpens in a new window or tabBrand NewS$ 7.10 to S$ 46.95+S$ 34.63 shipping estimatefrom United KingdomCustoms services and international tracking providedddogtreats (6,425) 100%
- Natural Dog Treat Selection Pack | 30+ Chew Treats, Pigs Ears, Rabbit, ChickenOpens in a new window or tabBrand NewS$ 19.91 to S$ 42.68+S$ 26.90 shipping estimatefrom United Kingdom401+ watchersCustoms services and international tracking providednorfolk-feeds (130,807) 99.7%
- Pet Center Quakers Duck Breast Fillets Treat Slow Roasted Low-Fat Chew Food 3 ozOpens in a new window or tabBrand NewS$ 13.98List price: S$ 15.5810% off+S$ 7.09 postagefrom United StatesTop-rated sellerTop-rated sellerlittle.family.members (162,542) 99.1%
- STAR Treat Soft Chewy Chicken Breast Strips - Treats Dog! easy cut chews jerkyOpens in a new window or tabBrand NewS$ 24.18 to S$ 46.95+S$ 43.03 shipping estimatefrom United Kingdom98+ soldCustoms services and international tracking providedddogtreats (6,425) 100%
- Obedient Aussie Dog Chew Premium Dog Treat Value Pack For All Size DogsOpens in a new window or tabBrand NewS$ 22.54+S$ 18.38 postagefrom Australiaobedient-aussie-dog-chew (19) 100%
- Natural Pet Treats Unlimited Natural Dog Treat Chew Best Norway Selling BrandOpens in a new window or tabBrand NewS$ 6.81 to S$ 44.38+S$ 35.64 shipping estimatefrom United KingdomCustoms services and international tracking providedpawstradinguk (136,238) 99.7%
- Extra Large XL Pigs Ears Dog Treat ChewOpens in a new window or tabBrand NewS$ 25.56 to S$ 49.47+S$ 50.44 shipping estimatefrom United KingdomCustoms services and international tracking providedatipharm619 (285) 100%
- Dash Mini Dog Treat Maker - Makes 6 Treats, Nonstick - RedOpens in a new window or tabBrand NewS$ 29.32+S$ 66.96 postagefrom United Statesjaze_collectibles (158) 97.8%
- StarMark Everlasting Small Dog Treat Hard Dental Chew Chicken Flavored 2-CountOpens in a new window or tabBrand NewS$ 11.89+S$ 6.49 postagefrom United StatesTop-rated sellerTop-rated sellerlittle.family.members (162,542) 99.1%
- Purina Beneful Made in USA Facilities Dog Treats, Baked Delights Hugs With RealOpens in a new window or tabBrand NewS$ 26.33+S$ 23.44 postagefrom United Statesaulona.sc (771) 98%
- Bulls Pizzle Stick 500g Misfits Bully Stick 100% Naturally Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 37.55+S$ 86.32 shipping estimatefrom United KingdomCustoms services and international tracking providedkcpettreats (3,164) 99.8%
- Beef Liver Training Treats Jerky 100% Natural Dried Dog Treat Small Dogs XS TreaOpens in a new window or tabBrand NewS$ 8.52 to S$ 51.21+S$ 48.33 shipping estimatefrom United KingdomCustoms services and international tracking provideddrieddogtreats (13,202) 100%
- Good Boy Soft Meaty Dog Treat Sticks Training Beef Chicken Duck Peanut ButterOpens in a new window or tabBrand NewS$ 3.63 to S$ 20.32+S$ 34.70 shipping estimatefrom United KingdomCustoms services and international tracking provided0314stepintopetsworld (45,583) 99%
- Pedigree Multipack x24 Rodeo Duos x4 Jumbone Dog Treat Snacks, Mega Box Bulk BuyOpens in a new window or tabBrand NewS$ 18.78+S$ 48.79 shipping estimatefrom United KingdomCustoms services and international tracking providedjahanzemirz-0 (360) 95.5%
- Meat Filled Hooves Natural Dog Chew Treat - High Protein Healthy Snack - DogOpens in a new window or tabBrand NewS$ 23.69 to S$ 172.33+S$ 47.28 shipping estimatefrom United KingdomCustoms services and international tracking providedplantsparty (4,876) 98.3%
- 2 X Doggie Delights Dog Treat Training Reward Multiple Flavour Beef Chicken DuckOpens in a new window or tabBrand NewS$ 19.62+S$ 48.84 shipping estimatefrom United KingdomCustoms services and international tracking provideddkjcbargains (948) 98.5%
- 2kg Rabbit Ears Natural with fur Hair Hypoallergenic Dog Treat ChewOpens in a new window or tabBrand NewS$ 68.29+S$ 87.98 shipping estimatefrom United Kingdom8 watchersCustoms services and international tracking providedcricketinnpetandanimalfeeds (2,824) 99.3%
- Dried Dog Treats [A171] Chicken Soft Strips with Fish Snack for Dogs Treat ChewsOpens in a new window or tabBrand NewS$ 7.10 to S$ 46.95+S$ 48.24 shipping estimatefrom United KingdomCustoms services and international tracking providedddogtreats (6,425) 100%
- Dog Treat Pouch Dog Poop Bag Holder Pet Waste Bag Dispenser Dog Training =Opens in a new window or tabBrand NewS$ 7.68Was: S$ 8.186% offFree International Shippingfrom ChinaTop-rated sellerTop-rated sellermingriz-9 (1,065) 96.4%
- FRUITABLES Skinny Minis Apple Bacon Trainers 12 ounce Treat Pouch for Dogs PetsOpens in a new window or tabBrand NewS$ 24.01+S$ 9.89 postagefrom United StatesTop-rated sellerTop-rated sellerlittle.family.members (162,542) 99.1%
- Dog Treats Small Puppy Training Treats 840g Puppies Toy Dogs BULK FLAVOURSOpens in a new window or tabBrand NewS$ 24.18+S$ 43.03 shipping estimatefrom United KingdomCustoms services and international tracking providedpawstradinguk (136,238) 99.7%
- Coffee Wood Dog Chew Natural Vegan Chewing Stick Dental Care Training TreatOpens in a new window or tabBrand NewS$ 9.95 to S$ 21.33+S$ 26.43 shipping estimatefrom United KingdomCustoms services and international tracking provided**vetfleece** (22,272) 98.7%
- Natural Rabbit Ears with Fur 40pk | Hypoallergenic Dog Chew Treat | True DogOpens in a new window or tabBrand NewS$ 30.38+S$ 43.12 shipping estimatefrom United Kingdom122 soldCustoms services and international tracking providednorfolk-feeds (130,807) 99.7%
- 500g Beef Liver Training Treats Jerky 100% Natural Dried Dog Treat Small DogsOpens in a new window or tabBrand NewS$ 22.75+S$ 49.25 shipping estimatefrom United KingdomCustoms services and international tracking providedddogtreats (6,425) 100%
- 100% Premium Sausages Dog Treat Reward Venison Chicken Cheese Beef Black PuddingOpens in a new window or tabBrand NewS$ 3.20+S$ 47.98 shipping estimatefrom United KingdomCustoms services and international tracking provided0314stepintopetsworld (45,583) 99%
- Beef Skin Natural Dog Chew Treat Healthy Snack - Dog Pick and MixOpens in a new window or tabBrand NewS$ 8.68 to S$ 56.89+S$ 34.73 shipping estimatefrom United KingdomCustoms services and international tracking providedplantsparty (4,876) 98.3%
- New Listing2x300g Garfield Chicken & Cheese Cat Kitten Biscuits Treats Supremies CrunchyOpens in a new window or tabBrand NewS$ 20.41+S$ 40.21 shipping estimatefrom United KingdomCustoms services and international tracking provideddantomlinson (167) 100%
- 100% Natural Healthy Dried Chicken Necks Dog Treat Treats Joint Aid GlucosamineOpens in a new window or tabBrand NewS$ 3.20 to S$ 18.49+S$ 47.98 shipping estimatefrom United Kingdom10+ watchersCustoms services and international tracking provided0314stepintopetsworld (45,583) 99%
- Pointer Milky Cheesy Bones Small Bite Mini Dog Treat Reward Puppy Adult TrainingOpens in a new window or tabBrand NewS$ 11.17 to S$ 68.29+S$ 48.50 shipping estimatefrom United KingdomCustoms services and international tracking providedsuperpet-ltd (212,828) 99.5%
- Pizzle Stick Thin 6'' (15cm) Bully Stick Chew Natural Dog TreatOpens in a new window or tabBrand NewS$ 11.94 to S$ 78.53+S$ 42.13 shipping estimatefrom United KingdomCustoms services and international tracking providedkcpettreats (3,164) 99.8%
- Pet Munchies Dog Food Training Treats Chew Sushi Venison Duck Chicken-50g -8pcsOpens in a new window or tabBrand NewS$ 24.74+S$ 42.81 shipping estimatefrom United KingdomCustoms services and international tracking providedsafastoresltd_1 (515) 100%
- Thick Bulls Pizzle 5" (10 pack) Chunky Bully Stick 100% Natural Dog Treat ChewOpens in a new window or tabBrand NewS$ 34.14+S$ 79.10 shipping estimatefrom United KingdomCustoms services and international tracking providedkcpettreats (3,164) 99.8%
- Webbox Chomping Chomp Chews Dog Treat Reward (10x200g Packs)Opens in a new window or tabBrand NewS$ 25.60+S$ 49.44 shipping estimatefrom United Kingdom725+ soldCustoms services and international tracking providedexpress-pet-supplies-uk (63,898) 99.8%
- Buffalo Ears Extra Large XL with Meat 100% Natural Air Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 3.20 to S$ 45.52+S$ 41.68 shipping estimatefrom United Kingdom32+ soldCustoms services and international tracking provided0314stepintopetsworld (45,583) 99%
- Chicken Lamb Duck Beef Jerky Sticks 100% Natural Dog Treats Dog Chews Dog SnacksOpens in a new window or tabBrand NewS$ 8.52 to S$ 32.72+S$ 34.77 shipping estimatefrom United KingdomCustoms services and international tracking provideddrieddogtreats (13,202) 100%
- Goat Ears with Fur 100% Naturally Air Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 14.22 to S$ 69.71+S$ 49.25 shipping estimatefrom United KingdomCustoms services and international tracking providedexpress-pet-supplies-uk (63,898) 99.8%
- Redbarn Pet Products Filled Bone Natural Chicken & Apple Dog TreatOpens in a new window or tabBrand NewS$ 13.12 to S$ 43.90+S$ 41.36 postagefrom United Statespet_food_network_online (92,786) 99.8%
- Hollings Duck Treat Strips Dog Meat Treats Natural Dried Jerky Bars Sticks 100gOpens in a new window or tabBrand NewS$ 7.10 to S$ 55.48+S$ 34.63 shipping estimatefrom United KingdomCustoms services and international tracking providedpurelypetsupplies (105,668) 99%
- GoodBoy Pawsley Chicken Fillet Dog Treat 320gOpens in a new window or tabBrand NewS$ 17.06+S$ 56.57 shipping estimatefrom United KingdomCustoms services and international tracking providedthepetsuperstore (26,492) 99.8%
- Fish skin twists a natural dog treat made from 100% fish skin 25 - 30 piecesOpens in a new window or tabBrand NewS$ 22.18+S$ 42.67 shipping estimatefrom United Kingdom15 watchersCustoms services and international tracking providedsapstyle (424) 99.2%
- Dog Treat Sausages 70% Meat High Quality Grain Free Choice of Flavors UK MADEOpens in a new window or tabBrand NewS$ 10.23 to S$ 46.09+S$ 36.65 shipping estimatefrom United KingdomCustoms services and international tracking providedpawstradinguk (136,238) 99.7%
- Pedigree/Chewdle/Pointer Gravy Bones Original, Chicken Dog Treat/Biscuit@MelianOpens in a new window or tabBrand NewS$ 1.85 to S$ 18.49+S$ 56.20 shipping estimatefrom United KingdomCustoms services and international tracking providedmelian00_0 (23,442) 100%
- Merry & Bright Dog Treats JUST BE- CLAUS JERKY Beef Flavor FRONEOpens in a new window or tabBrand NewS$ 21.99+S$ 13.43 postagefrom United Statesbigyardcentral20 (49) 100%
- Pork Sausages Natural Dog Chew Treat Protein Healthy Snack - Dog Pick and MixOpens in a new window or tabBrand NewS$ 7.10 to S$ 41.11+S$ 36.82 shipping estimatefrom United KingdomCustoms services and international tracking providedplantsparty (4,876) 98.3%
- Hollow Cow Hooves Natural Dog Chew Treat Healthy Snack - Dog Pick and MixOpens in a new window or tabBrand NewS$ 18.14 to S$ 109.22+S$ 48.51 shipping estimatefrom United KingdomCustoms services and international tracking providedplantsparty (4,876) 98.3%
- Items Per Page