290,000+ results for treat
- Natural Pet Treats Unlimited Natural Dog Treat Chew Best Norway Selling BrandOpens in a new window or tabBrand NewS$ 6.76 to S$ 44.05Customs services and international tracking providedpawstradinguk (135,957) 99.7%+S$ 32.44 shipping estimatefrom United Kingdom
- Natural Dog Treats MASSIVE Selection Box Fantastic Value With FREE P&POpens in a new window or tabBrand NewS$ 44.83Customs services and international tracking provideddogshealthshop (4,551) 100%+S$ 32.66 shipping estimatefrom United Kingdom
- Hide Free Zero Hide Low Fat Donut Ring Rings Chicken Peanut Butter Dog TreatOpens in a new window or tabBrand NewS$ 5.64 to S$ 17.73Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 31.39 shipping estimatefrom United Kingdom
- Cow Ears Dog Treats, 100% Natural & Nutritious Long Lasting Chew TreatsOpens in a new window or tabBrand NewS$ 2.81 to S$ 38.12Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 32.71 shipping estimatefrom United Kingdom5+ watchers
- New ListingTreat CD The EndgameOpens in a new window or tabBrand NewS$ 50.50Top-rated sellerTop-rated sellern-lion (8,238) 99.3%Free International Shippingfrom Japan
- DOUBLE TREAT WANDER THIRST CD New 4260072379367Opens in a new window or tabBrand NewS$ 31.39netdiscs (7,696) 99.8%+S$ 13.86 postagefrom United Kingdom
- Webbox Chomping Chomp Chews Dog Treat Reward (10x200g Packs)Opens in a new window or tabBrand NewS$ 25.41Customs services and international tracking providedexpress-pet-supplies-uk (63,690) 99.8%+S$ 45.40 shipping estimatefrom United Kingdom724+ sold
- Pill Pockets Dog Treats, Chicken, Small Dog, 3.2-oz. 04539Opens in a new window or tabBrand NewS$ 25.59Top-rated sellerTop-rated sellergettycrafts_uk (10,229) 98.4%+S$ 18.47 postagefrom United States
- Natural Dog Treat Selection Pack | 30+ Chew Treats, Pigs Ears, Rabbit, ChickenOpens in a new window or tabBrand NewS$ 19.76 to S$ 42.36Customs services and international tracking providednorfolk-feeds (128,676) 99.7%+S$ 23.03 shipping estimatefrom United Kingdom400+ watchers
- WIGGLES CHICKEN COINS 120G | Tasty Treats for DogsOpens in a new window or tabBrand NewS$ 12.69Customs services and international tracking providedgiftery05 (1,008) 100%+S$ 38.18 shipping estimatefrom United Kingdom2 watchers
- DriedDogTreats Duck Breast Soft Thin Sticks Jerky Treat Snack Chew Healthy TrainOpens in a new window or tabBrand NewS$ 7.05 to S$ 42.36Customs services and international tracking provideddrieddogtreats (13,038) 100%+S$ 30.71 shipping estimatefrom United Kingdom
- Letterbox Dog Natural Treat Selection 20 Items! Value Chew GiftOpens in a new window or tabBrand NewS$ 10.15Customs services and international tracking providedpetorama_petshop (1,285) 99.5%+S$ 34.44 shipping estimatefrom United Kingdom160 watchers
- Duck Mini Jerky Sticks 100% Natural Dog Treats Soft Chews Senior Puppy TrainingOpens in a new window or tabBrand NewS$ 9.87 to S$ 26.82Customs services and international tracking provideddrieddogtreats (13,038) 100%+S$ 38.15 shipping estimatefrom United Kingdom
- ORGANIC Varuna Bark 20:1 Extract Capsules Crataeva Nurvala Treats wormsOpens in a new window or tabBrand NewS$ 11.08 to S$ 70.42Top-rated sellerTop-rated sellerindian_bulk_exporter (5,904) 97.5%Free International Shippingfrom IndiaFree returns
- Buffalo Ears Extra Large XL with Meat 100% Natural Air Dried Dog Treat ChewOpens in a new window or tabBrand NewS$ 2.81 to S$ 43.77Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 40.32 shipping estimatefrom United Kingdom3+ watchers
- *Wagg Semi Moist Dog Treats Sensitive Low Fat Training Reward Skin Coat PuppyOpens in a new window or tabBrand NewS$ 4.59Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 44.05 shipping estimatefrom United Kingdom31+ sold
- Deer Venison Skin (15cm) Jerky 100% Natural Dried Dog Treat Long Lasting SnacksOpens in a new window or tabBrand NewS$ 19.76 to S$ 42.36Customs services and international tracking providedddogtreats (6,329) 99.9%+S$ 38.78 shipping estimatefrom United Kingdom
- Pointer Beef Gravy Bones Oven-Baked Dog Biscuit Food Treat Complimentary SnackOpens in a new window or tabBrand NewS$ 7.05 to S$ 25.41Customs services and international tracking providedpackagepets (67,144) 99%+S$ 30.71 shipping estimatefrom United Kingdom
- Pet Munchies Dog Food Training Treats Chew Sushi Venison Duck Chicken-50g -8pcsOpens in a new window or tabBrand NewS$ 24.56Customs services and international tracking providedsafastoresltd_1 (345) 100%+S$ 38.83 shipping estimatefrom United Kingdom
- Quality Treat Dog Puppy Treat Box - Dog Safe ChocolateOpens in a new window or tabBrand NewS$ 18.56Customs services and international tracking providedkris-lamb1988 (1,264) 100%+S$ 44.42 shipping estimatefrom United Kingdom
- Dried Chicken Fillets 1kg - Natural Treat for Dogs, Premium Jerky, True DogOpens in a new window or tabBrand NewS$ 37.27Customs services and international tracking providednorfolk-feeds (128,676) 99.7%+S$ 101.88 shipping estimatefrom United Kingdom42 sold
- Treat Her Right Junkyard CD Promo SingleOpens in a new window or tabPre-OwnedS$ 15.40Top-rated sellerTop-rated sellerurban_picker (113,761) 99.5%+S$ 19.71 postagefrom United StatesFree returns
- New ListingNatural Dog Treats-Dental Care Set-Toothbrush,toothpaste,brush cleaner size Med.Opens in a new window or tabBrand NewS$ 22.19discountdayz (755) 99.2%+S$ 35.19 postagefrom United States
- Marvel Trading Card Treats - Set of 6. Art by Jim Lee. Impel - 1991Opens in a new window or tabPre-OwnedS$ 5.34Top-rated sellerTop-rated selleral-and-son (2,953) 99.6%+S$ 4.26 postagefrom Canada
- Pack Of 2 or 4 Roasted Pork Flavour Bones 20cm Large Dog Chew Treat Real MeatOpens in a new window or tabBrand NewS$ 11.28 to S$ 16.88Top-rated sellerTop-rated sellerCustoms services and international tracking provided+S$ 30.98 shipping estimateyoureverydaystuff (207,237) 99.1%from United Kingdom84+ sold
- Premium Quality Wild Icelandic Cod Skin Flatties 100% Organic Dog Treat 150 gOpens in a new window or tabBrand NewS$ 20.30rafkinas (1,444) 100%+S$ 27.69 postagefrom United Kingdom
- 100% Natural Fruit Dog-Pup Treat Vegetarian Training Quick Reward Treat 160 gOpens in a new window or tabBrand NewS$ 14.76rafkinas (1,444) 100%+S$ 31.39 postagefrom United Kingdom
- Letterbox Chocolates Dog Puppy Treat Box - Dog Safe ChocolateOpens in a new window or tabBrand NewS$ 15.17Customs services and international tracking providedkris-lamb1988 (1,264) 100%+S$ 38.32 shipping estimatefrom United Kingdom
- Large 40cm Long Beef Trachea Dog Chew TreatOpens in a new window or tabBrand NewS$ 11.85Customs services and international tracking providedrounceproductslimited (143) 100%+S$ 38.15 shipping estimatefrom United Kingdom
- 10 x Pet Munchies Dog Food Training Treats Liver Chicken Sushi Venison Duck -50gOpens in a new window or tabBrand NewS$ 31.86Customs services and international tracking providedsafastoresltd_1 (345) 100%+S$ 39.22 shipping estimatefrom United Kingdom
- 100% Natural Healthy Dried Chicken Necks Dog Treat Treats Joint Aid GlucosamineOpens in a new window or tabBrand NewS$ 3.18 to S$ 18.35Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 43.96 shipping estimatefrom United Kingdom10+ watchers
- Dog Itchy Skin Relief Allergy Immune System Support Dogs Treats Chews 150 DuckOpens in a new window or tabBrand NewS$ 24.62Top-rated sellerTop-rated sellerbuyremyhair (22,730) 98.7%+S$ 18.47 postagefrom United Kingdom70 watchers
- 5"-6" Natural Dog Chew Treat Meaty Beef Marrow Shank BoneOpens in a new window or tabBrand NewS$ 14.83ovadeks (2,613) 100%+S$ 44.09 postagefrom United States9 watchers
- Dog Treat Reward Magic Bone with Real Chicken, Beef & Vegetables Raw Hide FreeOpens in a new window or tabBrand NewS$ 7.61Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 44.25 shipping estimatefrom United Kingdom13+ sold
- Pointer Peanut Butter Small Bite Bones - Fold Hill Training Snack Reward TreatOpens in a new window or tabBrand NewS$ 10.95 to S$ 67.07Customs services and international tracking providedsuperpet-ltd (211,288) 99.5%+S$ 38.22 shipping estimatefrom United Kingdom
- [100g] ROE Mini Jerky Sticks - 100% Natural Dog Treats, Dog Snacks Venison TreatOpens in a new window or tabBrand NewS$ 11.28Customs services and international tracking provideddrieddogtreats (13,038) 100%+S$ 38.24 shipping estimatefrom United Kingdom
- StarMark Everlasting Small Dog Treat Hard Chew Chicken Flavored 2-Count - 4-PackOpens in a new window or tabBrand NewS$ 23.85Top-rated sellerTop-rated sellerlittle.family.members (162,206) 99.1%+S$ 9.32 postagefrom United States7 watchers
- New Listing6 x 150g Pet Munchies Chicken Dog Training Treats Grain Free Real Meat Low FatOpens in a new window or tabBrand NewS$ 40.68Customs services and international tracking providedtwilightlegend (3,553) 100%+S$ 75.22 shipping estimatefrom United Kingdom
- 100% Natural Long Buffalo Tail Tails Long Lasting Air Died Dog Chew TreatOpens in a new window or tabBrand NewS$ 4.22 to S$ 25.41Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 31.90 shipping estimatefrom United Kingdom2+ watchers
- Premium Beef Liver Dark - Healthy Natural Air Dried Dog Training Treats ChewsOpens in a new window or tabBrand NewS$ 5.49 to S$ 18.35Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 31.44 shipping estimatefrom United Kingdom18+ watchers
- Fold Hill Pointer Chicken Gravy Bones Dog Biscuit Treat Food Complimentary SnackOpens in a new window or tabBrand NewS$ 7.05 to S$ 42.36Customs services and international tracking providedpackagepets (67,144) 99%+S$ 30.71 shipping estimatefrom United Kingdom
- SUPERB QUALITY - 1kg Turkey Necks - TOP GRADE natural dog treats.Opens in a new window or tabBrand NewS$ 32.12Customs services and international tracking providedpawsparadise (60,088) 99.2%+S$ 39.24 shipping estimatefrom United Kingdom61 sold
- BESTSELLER!!! Chicken Wrapped Jerky Beef Twists Dog Treat Chews 10pieces RawhideOpens in a new window or tabBrand NewS$ 7.05 to S$ 42.36Customs services and international tracking provideddrieddogtreats (13,038) 100%+S$ 44.22 shipping estimatefrom United Kingdom64+ sold
- New Listing3 x 100g Dog Biscuits with Chocolate, Dog Safe Friendly Treats, Park Life Bix BOpens in a new window or tabBrand NewS$ 20.32Customs services and international tracking providedbreadnsoup (117) 100%+S$ 38.59 shipping estimatefrom United Kingdom
- Puppy Adult Dog Treat Letterbox Gift! Christmas Stocking Filler Value For MoneyOpens in a new window or tabBrand NewS$ 10.15Customs services and international tracking providedpetorama_petshop (1,285) 99.5%+S$ 44.30 shipping estimatefrom United Kingdom116 watchers
- ULTIMATE NATURAL DOG TREAT OSTRICH BILTONG PURE MEAT 100% NATURAL AIR DRIEDOpens in a new window or tabBrand NewS$ 13.54 to S$ 67.78Customs services and international tracking providedall.natural.pet.foods (606) 99.3%+S$ 38.24 shipping estimatefrom United Kingdom11+ sold
- 100% Natural Lamb Pate Luxury Top Quality Dog Food Treat Single Protein 4X 400 gOpens in a new window or tabBrand NewS$ 36.91rafkinas (1,444) 100%+S$ 46.17 postagefrom United Kingdom
- 2kg Rabbit Ears Natural with fur Hair Hypoallergenic Dog Treat ChewOpens in a new window or tabBrand NewS$ 67.78Customs services and international tracking providedcricketinnpetandanimalfeeds (2,799) 99.3%+S$ 83.66 shipping estimatefrom United Kingdom58 sold
- Dried Cow Calves HOOVES Grade A Empty Hoof Pet Treat Chew Dogs Natural Dog TreatOpens in a new window or tabBrand NewS$ 2.69 to S$ 18.46drieddogtreats (13,038) 100%+S$ 24.63 postagefrom United Kingdom
- Bakers Whirlers Bacon and Cheese Double Flavour Twisted Dog Treat 6 x 130gOpens in a new window or tabBrand NewS$ 16.91Customs services and international tracking providedxl-supply (4,836) 99.6%+S$ 44.68 shipping estimatefrom United Kingdom9 watchers
- 100% Organic Vegetarian Dog-Pup Quick Reward Training Treat Natural Fruit 160 gOpens in a new window or tabBrand NewS$ 14.76rafkinas (1,444) 100%+S$ 27.69 postagefrom United Kingdom
- Drools 30 MEATY DENTAL PACK TASTY DOG TREATS 600g JUMBO VALUE PACKOpens in a new window or tabBrand NewS$ 16.93Customs services and international tracking providedgiftery05 (1,008) 100%+S$ 52.49 shipping estimatefrom United KingdomAlmost gone2 watchers
- Good Boy Soft Meaty Dog Treat Sticks Training Beef Chicken Duck Peanut ButterOpens in a new window or tabBrand NewS$ 3.60 to S$ 20.17Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 30.49 shipping estimatefrom United Kingdom
- Trick or Treat by Robert Cray (CD, PROMO Single)Opens in a new window or tabPre-OwnedS$ 12.28Top-rated sellerTop-rated sellerurban_picker (113,761) 99.5%+S$ 19.67 postagefrom United StatesFree returns
- 3 x Packs Pooch & Mutt Turkey & Cranberry Christmas Treats - 120gOpens in a new window or tabBrand NewS$ 10.08Customs services and international tracking providedkris-lamb1988 (1,264) 100%+S$ 36.71 shipping estimatefrom United Kingdom
- An Unexpected Groovy Treat by Fini Tribe (CD, Feb-1993, Epic)Opens in a new window or tabPre-OwnedS$ 8.81Top-rated sellerTop-rated sellerurban_picker (113,761) 99.5%+S$ 17.90 postagefrom United StatesFree returns
- Natural Rabbit Ears with Fur 2kg | Hypoallergenic Dog Chew Treat @rawdogfoodukOpens in a new window or tabBrand NewS$ 74.57Customs services and international tracking providedrawdogfooduk (87) 100%+S$ 77.03 shipping estimatefrom United Kingdom
- Treat - Same CD #G16468Opens in a new window or tabPre-OwnedS$ 41.77tws-music (58,337) 99.3%+S$ 12.69 postagefrom Germany
- Monster mini chocolate jazzles treat/reward for dogs - 100% safe for dogs 130gOpens in a new window or tabBrand NewS$ 5.51Customs services and international tracking providedpetcentre2016 (84,790) 99.2%+S$ 30.54 shipping estimatefrom United Kingdom23 watchers
- Good Boy Pawsley Chewy Bones With Chicken 80g Dog Chew Treat 100% Natural MeatOpens in a new window or tabBrand NewS$ 6.77 to S$ 14.67Customs services and international tracking providedpackagepets (67,144) 99%+S$ 31.20 shipping estimatefrom United Kingdom30+ sold
- [100g] Roe Cubes Training Treats - 100% Natural Dog Treats Dog Snacks Small DogsOpens in a new window or tabBrand NewS$ 11.28Customs services and international tracking provideddrieddogtreats (13,038) 100%+S$ 38.24 shipping estimatefrom United Kingdom
- X3 Good Boy Duck Twists - Dog Treat.Opens in a new window or tabBrand NewS$ 18.64Customs services and international tracking providedmonty132009 (4,388) 99.8%+S$ 44.10 shipping estimatefrom United Kingdom
- Buddylicious Dog Treat Chews Gift Set Natural Healthy Dog PresentOpens in a new window or tabBrand NewS$ 16.93 to S$ 25.41Customs services and international tracking providedpjpetproducts (2,602) 99%+S$ 44.85 shipping estimatefrom United Kingdom
- StarMark Everlasting Dog Treat Toy Bacon Edible Dental Chew Small - 4 PackOpens in a new window or tabBrand NewS$ 24.46Top-rated sellerTop-rated sellerlittle.family.members (162,206) 99.1%+S$ 8.37 postagefrom United States
- DOG POPCORN TREAT BOX, 3 FLAVOURS, MULTIPACK BOX BIRTHDAY PRESENT TRAININGOpens in a new window or tabBrand NewS$ 13.56Customs services and international tracking providedbarry3027 (1,185) 100%+S$ 38.24 shipping estimatefrom United Kingdom
- New Listing6 x 100g Dog Biscuits with Chocolate, Dog Safe Friendly Treats, Park Life Bix BOpens in a new window or tabBrand NewS$ 28.80Customs services and international tracking providedbreadnsoup (117) 100%+S$ 45.30 shipping estimatefrom United Kingdom
- Himalayan Yak Dog Chews Chew Milk Cheese Natural Treat Bone Bulk Large FreshOpens in a new window or tabVariant Sizes Toy Bone TreatBrand NewS$ 4.75 to S$ 39.34sedhouse (404) 100%+S$ 41.89 postagefrom United States
- 100% Natural PORK AND APPLE Training Treat Quick Dog Or Puppy Reward Treat 200 gOpens in a new window or tabBrand NewS$ 18.46rafkinas (1,444) 100%+S$ 31.39 postagefrom United Kingdom
- Coffee Wood Dog Chew Natural Vegan Chewing Stick Dental Care Training TreatOpens in a new window or tabBrand NewS$ 9.87 to S$ 21.17Customs services and international tracking provided**vetfleece** (22,223) 99%+S$ 22.41 shipping estimatefrom United Kingdom
- BRAIDED BEEF SPAGHETTI NATURAL DOG TREAT/CHEW 100% AIR DRIED BOX OF 10 BRAIDSOpens in a new window or tabBrand NewS$ 16.86Customs services and international tracking providedall.natural.pet.foods (606) 99.3%+S$ 38.40 shipping estimatefrom United Kingdom23 watchers
- HOWLERS Rawhide Dog Chews Treat Shoe Natural 12.5cm Pack of 20Opens in a new window or tabBrand NewS$ 18.35Customs services and international tracking providedpjpetproducts (2,602) 99%+S$ 38.69 shipping estimatefrom United Kingdom124 sold
- Dog Activity Bag, Snack Bag, Treat bag, Training treat bag. 3227Opens in a new window or tabBrand NewS$ 7.74Customs services and international tracking providedmalsmatesrates (163,179) 99.1%+S$ 30.74 shipping estimatefrom United Kingdom
- DriedDogTreats [500g] Tied Bone with Chicken LUX, Tasty Snacks, Dog Treats ChewsOpens in a new window or tabBrand NewS$ 24.00Customs services and international tracking provideddrieddogtreats (13,038) 100%+S$ 53.12 shipping estimatefrom United Kingdom
- Dried Chicken Dog sausage, Natural Dog Treat Reward ChewOpens in a new window or tabBrand NewS$ 14.11 to S$ 49.42Customs services and international tracking providedexpress-pet-supplies-uk (63,690) 99.8%+S$ 40.69 shipping estimatefrom United Kingdom
- Paddy Wack 100% Beef Dog Chew Treat Long Lasting And Good For TeethOpens in a new window or tabBrand NewS$ 4.65 to S$ 33.88Customs services and international tracking provided0314stepintopetsworld (44,660) 99%+S$ 32.44 shipping estimatefrom United Kingdom8+ watchers
- Items Per Page
![[100g] ROE Mini Jerky Sticks - 100% Natural Dog Treats, Dog Snacks Venison Treat](https://i.ebayimg.com/thumbs/images/g/Gn0AAOSwN6BkBkRt/s-l300.jpg)
![[100g] Roe Cubes Training Treats - 100% Natural Dog Treats Dog Snacks Small Dogs](https://i.ebayimg.com/thumbs/images/g/BmIAAOSwXlJkBj1-/s-l300.jpg)
![DriedDogTreats [500g] Tied Bone with Chicken LUX, Tasty Snacks, Dog Treats Chews](https://i.ebayimg.com/thumbs/images/g/5dsAAOSwwlBgvkEm/s-l300.jpg)
